PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc02764.1.g00020.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 362aa    MW: 38826.4 Da    PI: 10.5681
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc02764.1.g00020.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.84.3e-19184238256
                                   T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                      Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                   rk+ +++k+q  +Le++F+ +++++ +++  LA++lgL  rqV vWFqNrRa+ k
  Zpz_sc02764.1.g00020.1.am.mk 184 RKKLRLSKDQAAVLEDCFKTHSTLNPKQKVALANRLGLRPRQVEVWFQNRRARTK 238
                                   678899***********************************************98 PP

2HD-ZIP_I/II125.42.5e-40184272189
                   HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLe 81 
                                   +kk+rlsk+q+++LE++F+++++L+p++Kv+la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l++en+rLe
  Zpz_sc02764.1.g00020.1.am.mk 184 RKKLRLSKDQAAVLEDCFKTHSTLNPKQKVALANRLGLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRWCERLADENKRLE 264
                                   69******************************************************************************* PP

                   HD-ZIP_I/II  82 keveeLre 89 
                                   ke ++L++
  Zpz_sc02764.1.g00020.1.am.mk 265 KELADLKA 272
                                   ****9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.439180240IPR001356Homeobox domain
SMARTSM003891.1E-16182244IPR001356Homeobox domain
SuperFamilySSF466896.42E-18182249IPR009057Homeodomain-like
PfamPF000462.3E-16184238IPR001356Homeobox domain
CDDcd000861.06E-14184241No hitNo description
Gene3DG3DSA:1.10.10.601.5E-17184238IPR009057Homeodomain-like
PRINTSPR000315.8E-5211220IPR000047Helix-turn-helix motif
PROSITE patternPS000270215238IPR017970Homeobox, conserved site
PRINTSPR000315.8E-5220236IPR000047Helix-turn-helix motif
SMARTSM003401.1E-16240283IPR003106Leucine zipper, homeobox-associated
PfamPF021832.5E-9240272IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MSEGARGEER VKNSKEAGDG GMGAWPCLMA GRAMMGERGI RTTAHDSRLC GATRLQLFIA  60
PAFSTQSRTH RTTVFVFSSH LLRLGGLTSQ SSLSSSTTSG QLSPWAAALN SVVGDARRDQ  120
ARTADPADQG TRRPSTSPDS SAALSSGDSG SNKRERDREL ERTGSVNGVR GGAGSDEEDG  180
AGGRKKLRLS KDQAAVLEDC FKTHSTLNPK QKVALANRLG LRPRQVEVWF QNRRARTKLK  240
QTEVDCEYLK RWCERLADEN KRLEKELADL KAAPSPAAAA TQRSSAAAAL TMCPSCRRVA  300
STAGAGTQHH QQQCHPKSNT AAVAGNVRPS HCQFFPAAVD RTPGQSTWNA AAAAPLVTRE  360
LF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1232240RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0932881e-120FP093288.1 Phyllostachys edulis cDNA clone: bphylf053m07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004964497.11e-111PREDICTED: homeobox-leucine zipper protein HOX2-like
SwissprotQ5VPE32e-92HOX2_ORYSJ; Homeobox-leucine zipper protein HOX2
SwissprotQ84U862e-92HOX2_ORYSI; Homeobox-leucine zipper protein HOX2
TrEMBLK3XYL11e-111K3XYL1_SETIT; Uncharacterized protein
STRINGSi007019m1e-111(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38423376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.17e-50homeobox from Arabidopsis thaliana